Srikanchimahaswamividyamandir.edu.in

Visit srikanchimahaswamividyamandir.edu.in
  • 8 months ago

    Last scanned

  • No data

    Domain Age

  • No data

    Daily Visitors

  • No data

    Global Rank

B9876A78-C14B-4F49-9F4B-396039336A47@1x

About Website

Updated:

Sri Kanchi Mahaswami Vidya Mandir, Tambaram, Chennai.

Sri Kanchi Mahaswami Vidya Mandir CBSE School, Chennai, Welcome to Sri Kanchi Mahaswami Vidya Mandir, a unique school, from Sri Kanchi Mahaswami Trust.

Srikanchimahaswamividyamandir.edu.in thumbnail
Srikanchimahaswamividyamandir.edu.in thumbnail

Trustworthy

99E6BC28-40D1-4264-B66E-CBC423C983BF@1x

Network Data

This website is hosted with GDRPL route object at TCL,Chennai, which reserves the following IP addresses for srikanchimahaswamividyamandir.edu.in: 103.14.120.147. Moreover, DNS used with this website include ns1.555servers.net, ns2.555servers.net, ns3.555servers.net, ns4.555servers.net.

  • 8 months ago

    Last scanned

  • No data

    Domain Age

  • No data

    Daily Visitors

  • No data

    Global Rank

Trustworthy

Network

ADDRESSING DETAILS

Whois

At present, the WHOIS information for srikanchimahaswamividyamandir.edu.in is unfortunately not available. Due to various potential reasons such as privacy protections, data maintenance, or registrar restrictions, we are unable to provide specific details about srikanchimahaswamividyamandir.edu.in's registration and ownership status at this time.

Domain & Keywords

  • Chennai
  • cbse schools in chennai
  • top cbse schools in chennai
  • sri kanchi mahaswami vidya mandir
  • Vedic Education School

Websites similar to srikanchimahaswamividyamandir.edu.in