WWW.GOODBODY.IE
Visit www.goodbody.ie



Expert Advice, Goodbody Stockbrokers
Trust, integrity and expert advice have been the foundations of our relationships with our clients for over 140 years
Keywords: goodbody, financial health check, good body, gudhjkiody, stockbrokers ireland, goodbody ireland
Daily visitors: 534
Daily pageviews: 534
Alexa Rank: 1164400
Created: 1998-07-09
Expires: 2018-07-09
Owner: G
Hosting company: CloudFlare, Inc.
Registrar: IE Domain Registry
IPs: 104.16.212.134, 104.16.213.134
DNS: duke.ns.cloudflare.com
lana.ns.cloudflare.com
Goodbody.ie thumbnail

Similar sites

efinancialmanagement.com.au

Confident Cashflows - Supporting Business Owners to Make & Keep More Money Perth, Australia.

onepathfp.com.au

Planning for success | One Path FP

confidentcashflowsplus.com.au

Accountant Perth - Cash Flow Analysis – Confident Cashflows -

wealthmakerfinancialservices.com.au

WealthMaker Financial Services | Wealth Creation and Management

nationalcorp.com.au

Better Choice Home Loans